Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody

Details for Product No. ABIN565003
Target
Binding Specificity
AA 30-406
11
4
2
2
2
1
1
1
1
Reactivity
Human
38
7
6
3
3
3
3
3
3
3
2
2
2
2
1
1
1
Host
Mouse
25
7
7
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP), ELISA, Western Blotting (WB)
26
17
10
10
7
3
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a full length recombinant TXNDC4.
Immunogen

immunogen: TXNDC4 (AAH05374, 30 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Clone 3C7
Isotype IgG2b kappa
Cross-Reactivity Human
Target
Alternative Name TXNDC4 (ERP44 Antibody Abstract)
Background Full Gene Name: thioredoxin domain containing 4 (endoplasmic reticulum)
Synonyms: ERP44,KIAA0573
Gene ID 23071
Pathways Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 mo...
Image no. 2 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) Immunoprecipitation of TXNDC4 transfected lysate using anti-TXNDC4 monoclonal antibod...
Image no. 3 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) Detection limit for recombinant GST tagged TXNDC4 is 1 ng/ml as a capture antibody.
Image no. 4 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) Western Blot detection against Immunogen (67.21 KDa) .
Image no. 5 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) Immunoperoxidase of monoclonal antibody to TXNDC4 on formalin-fixed paraffin-embedded...
Image no. 6 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) TXNDC4 monoclonal antibody (M01), clone 3C7 Western Blot analysis of TXNDC4 expressio...
Image no. 7 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibody (ABIN565003) TXNDC4 monoclonal antibody (M01), clone 3C7. Western Blot analysis of TXNDC4 expressi...