AP3M2 antibody (Middle Region)
-
- Target See all AP3M2 Antibodies
- AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AP3M2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AP3 M2 antibody was raised against the middle region of AP3 2
- Purification
- Affinity purified
- Immunogen
- AP3 M2 antibody was raised using the middle region of AP3 2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID
- Top Product
- Discover our top product AP3M2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AP3M2 Blocking Peptide, catalog no. 33R-9888, is also available for use as a blocking control in assays to test for specificity of this AP3M2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))
- Alternative Name
- AP3M2 (AP3M2 Products)
- Synonyms
- wu:fc15g12 antibody, zgc:86670 antibody, AP47B antibody, CLA20 antibody, P47B antibody, 5830445E16Rik antibody, AP-3B antibody, adaptor related protein complex 3 mu 2 subunit antibody, AP-3 complex subunit mu-2 antibody, adaptor-related protein complex 3, mu 2 subunit antibody, adaptor related protein complex 3 mu 2 subunit S homeolog antibody, AP3M2 antibody, ap3m2 antibody, LOC582979 antibody, ap3m2.S antibody, Ap3m2 antibody
- Background
- AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.
- Molecular Weight
- 47 kDa (MW of target protein)
-