PRMT3 antibody (Middle Region)
-
- Target See all PRMT3 Antibodies
- PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRMT3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRMT3 antibody was raised against the middle region of PRMT3
- Purification
- Affinity purified
- Immunogen
- PRMT3 antibody was raised using the middle region of PRMT3 corresponding to a region with amino acids LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
- Top Product
- Discover our top product PRMT3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRMT3 Blocking Peptide, catalog no. 33R-4896, is also available for use as a blocking control in assays to test for specificity of this PRMT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))
- Alternative Name
- PRMT3 (PRMT3 Products)
- Synonyms
- HRMT1L3 antibody, 2010005E20Rik antibody, 2410018A17Rik antibody, AL033309 antibody, Hrmt1l3 antibody, PRMT3 antibody, hrmt1l3 antibody, zgc:112498 antibody, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 3 antibody, ATPRMT3 antibody, protein arginine methyltransferase 3 antibody, protein arginine methyltransferase 3 antibody, protein arginine N-methyltransferase 3 antibody, protein arginine methyltransferase 3 S homeolog antibody, PRMT3 antibody, Prmt3 antibody, prmt3 antibody, prmt3.S antibody
- Background
- Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-