MRPL13 antibody (Middle Region)
-
- Target See all MRPL13 Antibodies
- MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRPL13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MRPL13 antibody was raised against the middle region of MRPL13
- Purification
- Affinity purified
- Immunogen
- MRPL13 antibody was raised using the middle region of MRPL13 corresponding to a region with amino acids AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD
- Top Product
- Discover our top product MRPL13 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRPL13 Blocking Peptide, catalog no. 33R-1286, is also available for use as a blocking control in assays to test for specificity of this MRPL13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))
- Alternative Name
- MRPL13 (MRPL13 Products)
- Synonyms
- CG10602 antibody, CG10603 antibody, Dmel\\CG10603 antibody, L13 antibody, anon-EST:fe3C4 antibody, GB12738 antibody, MGC135435 antibody, zgc:109948 antibody, MRPL13 antibody, YK105 antibody, L13A antibody, L13mt antibody, RPL13 antibody, RPML13 antibody, 1110002D09Rik antibody, mitochondrial ribosomal protein L13 antibody, 39S ribosomal protein L13, mitochondrial antibody, mitochondrial ribosomal protein L13 S homeolog antibody, mitochondrial 54S ribosomal protein YmL13 antibody, Putative mitochondrial ribosomal protein L13 antibody, mRpL13 antibody, LOC413928 antibody, MRPL13 antibody, mrpl13.S antibody, mrpl13 antibody, LOC770396 antibody, mrpL13 antibody, Mrpl13 antibody
- Background
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.
- Molecular Weight
- 21 kDa (MW of target protein)
-