MPEG1 antibody (C-Term)

Catalog No. ABIN632360

Product Details anti-MPEG1 Antibody

Target: MPEG1 (Macrophage Expressed Gene 1 (MPEG1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPEG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPEG1 antibody was raised against MPEG1

Purification: Affinity purified

Immunogen: MPEG1 antibody was raised using a region of MPEG1 corresponding to amino acids: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPEG1 Blocking Peptide, is also available for use as a blocking control in assays to test for specificity of this MPEG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPEG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPEG1

Target: MPEG1 (Macrophage Expressed Gene 1 (MPEG1))

Alternative Name: MPEG1 (MPEG1 Products)

Synonyms: MPEG1 antibody, DKFZp469A1716 antibody, MPG1 antibody, MPS1 antibody, Mpg-1 antibody, fj09e08 antibody, wu:fb14d06 antibody, wu:fj09e08 antibody, zgc:66409 antibody, macrophage expressed 1 antibody, macrophage expressed 1, tandem duplicate 1 antibody, macrophage expressed gene 1 antibody, MPEG1 antibody, Mpeg1 antibody, mpeg1.1 antibody

Background: The function of MPEG1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 78 kDa (MW of target protein)