SLC12A1 antibody
-
- Target See all SLC12A1 Antibodies
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC12A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- SLC12 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
- Top Product
- Discover our top product SLC12A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC12A1 Blocking Peptide, catalog no. 33R-6671, is also available for use as a blocking control in assays to test for specificity of this SLC12A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
- Alternative Name
- SLC12A1 (SLC12A1 Products)
- Synonyms
- slc12a1 antibody, SLC12A1 antibody, DKFZp469A2020 antibody, BSC1 antibody, NKCC2 antibody, Nkcc2 antibody, AI788571 antibody, D630042G03Rik antibody, mBSC1 antibody, urehr3 antibody, si:ch211-220f12.1 antibody, solute carrier family 12 member 1 antibody, solute carrier family 12, member 1 antibody, si:ch211-220f12.1 antibody, SLC12A1 antibody, Slc12a1 antibody
- Background
- The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
- Molecular Weight
- 47 kDa (MW of target protein)
-