CST8 antibody
-
- Target See all CST8 Antibodies
- CST8 (Cystatin 8 (CST8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CST8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Cystatin 8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY
- Top Product
- Discover our top product CST8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cystatin 8 Blocking Peptide, catalog no. 33R-5097, is also available for use as a blocking control in assays to test for specificity of this Cystatin 8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CST8 (Cystatin 8 (CST8))
- Alternative Name
- Cystatin 8 (CST8 Products)
- Synonyms
- CRES antibody, CTES5 antibody, Cres antibody, Cst-rs1 antibody, cystatin 8 antibody, cystatin 8 (cystatin-related epididymal spermatogenic) antibody, CST8 antibody, Cst8 antibody
- Background
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens.
- Molecular Weight
- 14 kDa (MW of target protein)
-