CHAC1 antibody

Catalog No. ABIN632509

Product Details anti-CHAC1 Antibody

Target: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHAC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHAC1 Blocking Peptide, catalog no. 33R-9229, is also available for use as a blocking control in assays to test for specificity of this CHAC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHAC1

Target: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Alternative Name: CHAC1 (CHAC1 Products)

Synonyms: 1810008K03Rik antibody, RGD1307153 antibody, ChaC glutathione specific gamma-glutamylcyclotransferase 1 antibody, ChaC, cation transport regulator 1 antibody, ChaC glutathione-specific gamma-glutamylcyclotransferase 1 antibody, CHAC1 antibody, Chac1 antibody

Background: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Molecular Weight: 24 kDa (MW of target protein)