RAP1 antibody (Middle Region)
-
- Target See all RAP1 (TERF2IP) Antibodies
- RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TERF2 IP antibody was raised against the middle region of TERF2 P
- Purification
- Affinity purified
- Immunogen
- TERF2 IP antibody was raised using the middle region of TERF2 P corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV
- Top Product
- Discover our top product TERF2IP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TERF2IP Blocking Peptide, catalog no. 33R-2322, is also available for use as a blocking control in assays to test for specificity of this TERF2IP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TERF0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))
- Alternative Name
- TERF2IP (TERF2IP Products)
- Synonyms
- DRIP5 antibody, RAP1 antibody, Rap1 antibody, cRAP1 antibody, TERF2 interacting protein antibody, telomeric repeat binding factor 2, interacting protein antibody, TERF2IP antibody, Terf2ip antibody
- Background
- The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Cell Division Cycle, Telomere Maintenance
-