PSMD10 antibody
-
- Target See all PSMD10 Antibodies
- PSMD10 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMD10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV
- Top Product
- Discover our top product PSMD10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMD10 Blocking Peptide, catalog no. 33R-6101, is also available for use as a blocking control in assays to test for specificity of this PSMD10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMD10 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10))
- Alternative Name
- PSMD10 (PSMD10 Products)
- Synonyms
- gankyrin antibody, zgc:109707 antibody, dJ889N15.2 antibody, p28 antibody, p28(GANK) antibody, AW554874 antibody, p28Gank antibody, proteasome 26S subunit, non-ATPase 10 antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 antibody, psmd10 antibody, PSMD10 antibody, Psmd10 antibody
- Background
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Maintenance of Protein Location, Synthesis of DNA, Ubiquitin Proteasome Pathway
-