ALKBH2 antibody
-
- Target See all ALKBH2 Antibodies
- ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALKBH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL
- Top Product
- Discover our top product ALKBH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALKBH2 Blocking Peptide, catalog no. 33R-9735, is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))
- Alternative Name
- ALKBH2 (ALKBH2 Products)
- Synonyms
- si:dkey-65b12.2 antibody, ABH2 antibody, 9530023G02 antibody, AU016977 antibody, Abh2 antibody, mABH2 antibody, RGD1306377 antibody, alkB homolog 2, alpha-ketoglutarate dependent dioxygenase antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase antibody, ALKBH2 antibody, alkbh2 antibody, Alkbh2 antibody
- Background
- The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-