ALKBH2 antibody

Catalog No. ABIN632988

Product Details anti-ALKBH2 Antibody

Target: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALKBH2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALKBH2 Blocking Peptide, catalog no. 33R-9735, is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALKBH2

Target: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Alternative Name: ALKBH2 (ALKBH2 Products)

Synonyms: si:dkey-65b12.2 antibody, ABH2 antibody, 9530023G02 antibody, AU016977 antibody, Abh2 antibody, mABH2 antibody, RGD1306377 antibody, alkB homolog 2, alpha-ketoglutarate dependent dioxygenase antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase antibody, ALKBH2 antibody, alkbh2 antibody, Alkbh2 antibody

Background: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: DNA Damage Repair