NR4A3 antibody (Middle Region)
-
- Target See all NR4A3 Antibodies
- NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR4A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TEC antibody was raised against the middle region of TEC
- Purification
- Affinity purified
- Immunogen
- TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG
- Top Product
- Discover our top product NR4A3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TEC Blocking Peptide, catalog no. 33R-9641, is also available for use as a blocking control in assays to test for specificity of this TEC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))
- Alternative Name
- TEC (NR4A3 Products)
- Synonyms
- CHN antibody, CSMF antibody, MINOR antibody, NOR1 antibody, TEC antibody, AI573420 antibody, NOR-1 antibody, Nor1 antibody, NOR-2 antibody, NR4A3 antibody, Nr4a3 antibody, nuclear receptor subfamily 4 group A member 3 antibody, nuclear receptor subfamily 4, group A, member 3 antibody, NR4A3 antibody, Nr4a3 antibody, nr4a3 antibody
- Background
- The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.
- Molecular Weight
- 73 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-