PRSS8 antibody (Middle Region)

Catalog No. ABIN633110

Product Details anti-PRSS8 Antibody

Target: PRSS8 (Protease, serine, 8 (PRSS8))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRSS8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRSS8 antibody was raised against the middle region of PRSS8

Purification: Affinity purified

Immunogen: PRSS8 antibody was raised using the middle region of PRSS8 corresponding to a region with amino acids PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRSS8 Blocking Peptide, catalog no. 33R-7163, is also available for use as a blocking control in assays to test for specificity of this PRSS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRSS8

Target: PRSS8 (Protease, serine, 8 (PRSS8))

Alternative Name: PRSS8 (PRSS8 Products)

Synonyms: CAP1 antibody, PROSTASIN antibody, prostasin antibody, 2410039E18Rik antibody, AI313909 antibody, C79772 antibody, fr antibody, mCAP1 antibody, protease, serine 8 antibody, protease, serine, 8 antibody, protease, serine 8 (prostasin) antibody, PRSS8 antibody, Prss8 antibody

Background: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Molecular Weight: 33 kDa (MW of target protein)