MAGEA5 antibody (N-Term)
-
- Target See all MAGEA5 Antibodies
- MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEA5 antibody was raised against the N terminal of MAGEA5
- Purification
- Affinity purified
- Immunogen
- MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL
- Top Product
- Discover our top product MAGEA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEA5 Blocking Peptide, catalog no. 33R-6458, is also available for use as a blocking control in assays to test for specificity of this MAGEA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))
- Alternative Name
- MAGEA5 (MAGEA5 Products)
- Synonyms
- CT1.5 antibody, MAGE5 antibody, MAGEA4 antibody, Mage-a5 antibody, MAGE family member A5 antibody, melanoma antigen, family A, 5 antibody, MAGEA5 antibody, Magea5 antibody
- Background
- This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature.
- Molecular Weight
- 13 kDa (MW of target protein)
-