ANGPTL3 antibody (N-Term)
-
- Target See all ANGPTL3 Antibodies
- ANGPTL3 (Angiopoietin-Like 3 (ANGPTL3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANGPTL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ANGPTL3 antibody was raised against the N terminal of ANGPTL3
- Purification
- Affinity purified
- Immunogen
- ANGPTL3 antibody was raised using the N terminal of ANGPTL3 corresponding to a region with amino acids IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
- Top Product
- Discover our top product ANGPTL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANGPTL3 Blocking Peptide, catalog no. 33R-3960, is also available for use as a blocking control in assays to test for specificity of this ANGPTL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANGPTL3 (Angiopoietin-Like 3 (ANGPTL3))
- Alternative Name
- ANGPTL3 (ANGPTL3 Products)
- Synonyms
- fb60e11 antibody, fb66h02 antibody, wu:fb60e11 antibody, wu:fb66h02 antibody, zgc:111943 antibody, ANGPTL3 antibody, LOC100230785 antibody, ANG-5 antibody, ANGPT5 antibody, ANL3 antibody, FHBL2 antibody, hypl antibody, angiopoietin-like 3 antibody, angiopoietin like 3 antibody, angptl3 antibody, ANGPTL3 antibody, Angptl3 antibody
- Background
- The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors.
- Molecular Weight
- 51 kDa (MW of target protein)
-