RENT1/UPF1 antibody

Catalog No. ABIN633191

Product Details anti-RENT1/UPF1 Antibody

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RENT1/UPF1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPF1 Blocking Peptide, catalog no. 33R-7945, is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RENT1/UPF1

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Alternative Name: UPF1 (UPF1 Products)

Synonyms: HUPF1 antibody, NORF1 antibody, RENT1 antibody, pNORF1 antibody, smg-2 antibody, B430202H16Rik antibody, PNORF-1 antibody, Rent1 antibody, Upflp antibody, rent1 antibody, wu:fi40f07 antibody, wu:fj48a01 antibody, zgc:55472 antibody, Tb05.3C6.50 antibody, AO090012000584 antibody, hupf1 antibody, norf1 antibody, pnorf1 antibody, upf1 antibody, UPF1, RNA helicase and ATPase antibody, UPF1 regulator of nonsense transcripts homolog (yeast) antibody, upf1 regulator of nonsense transcripts homolog (yeast) antibody, regulator of nonsense transcripts 1 antibody, Regulator of nonsense transcripts 1 antibody, UPF1 regulator of nonsense transcripts homolog S homeolog antibody, UPF1 antibody, Upf1 antibody, upf1 antibody, Tc00.1047053511317.30 antibody, Tb927.5.2140 antibody, TVAG_453890 antibody, TVAG_237840 antibody, AOR_1_1018194 antibody, HPB8_739 antibody, smg-2 antibody, upf1.S antibody

Background: UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.

Molecular Weight: 123 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome