RPL5 antibody (N-Term)

Catalog No. ABIN633202

Product Details anti-RPL5 Antibody

Target: RPL5 (Ribosomal Protein L5 (RPL5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPL5 antibody was raised against the N terminal of RPL5

Purification: Affinity purified

Immunogen: RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL5 Blocking Peptide, catalog no. 33R-8055, is also available for use as a blocking control in assays to test for specificity of this RPL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL5

Target: RPL5 (Ribosomal Protein L5 (RPL5))

Alternative Name: RPL5 (RPL5 Products)

Synonyms: DBA6 antibody, L5 antibody, U21RNA antibody, CG17489 antibody, Dmel\\CG17489 antibody, E-2d antibody, M(2)40B antibody, Rp L5 antibody, Rpl5 antibody, dRPL5 antibody, yip6 antibody, rpl5 antibody, wu:fj02g05 antibody, zgc:86854 antibody, mg:cb01f08 antibody, rpl5l antibody, zgc:56511 antibody, zgc:77176 antibody, ribosomal protein L5 antibody, 60S ribosomal protein L5 antibody, Ribosomal protein L5 antibody, ribosomal protein L5 L homeolog antibody, 50S ribosomal protein L5 antibody, ribosomal protein L5 S homeolog antibody, ribosomal protein L5b antibody, rpl5 antibody, ribosomal protein L5a antibody, Rpl5 antibody, RPL5 antibody, rpl-5 antibody, RpL5 antibody, rpl5.L antibody, rpl5 antibody, rpl5.S antibody, rpl5b antibody, rpl5a antibody

Background: RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Molecular Weight: 34 kDa (MW of target protein)