HNRNPA2B1 antibody (N-Term)
-
- Target See all HNRNPA2B1 Antibodies
- HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPA2B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNRNPA2 B1 antibody was raised against the N terminal of HNRNPA2 1
- Purification
- Affinity purified
- Immunogen
- HNRNPA2 B1 antibody was raised using the N terminal of HNRNPA2 1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
- Top Product
- Discover our top product HNRNPA2B1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRNPA2B1 Blocking Peptide, catalog no. 33R-5932, is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPA0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))
- Alternative Name
- HNRNPA2B1 (HNRNPA2B1 Products)
- Synonyms
- HNRNPA2 antibody, HNRNPB1 antibody, HNRPA2 antibody, HNRPA2B1 antibody, HNRPB1 antibody, RNPA2 antibody, SNRPB1 antibody, hnrpa2b1 antibody, MGC53135 antibody, HNRNPA2B1 antibody, hnrnpa2 antibody, hnrnpb1 antibody, hnrpa2 antibody, hnrpb1 antibody, rnpa2 antibody, snrpb1 antibody, 9130414A06Rik antibody, Hnrpa2 antibody, Hnrpa2b1 antibody, hnrnp-A antibody, hnRNP antibody, heterogeneous nuclear ribonucleoprotein A2/B1 antibody, heterogeneous nuclear ribonucleoprotein A2/B1 S homeolog antibody, heterogeneous nuclear ribonucleoproteins A2/B1 antibody, HNRNPA2B1 antibody, hnrnpa2b1.S antibody, hnrnpa2b1 antibody, Hnrnpa2b1 antibody, LOC100353281 antibody
- Background
- HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
- Molecular Weight
- 37 kDa (MW of target protein)
-