DHX9 antibody

Catalog No. ABIN633361

Product Details anti-DHX9 Antibody

Target: DHX9 (ATP-Dependent RNA Helicase A (DHX9))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX9 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX9 Blocking Peptide, catalog no. 33R-3397, is also available for use as a blocking control in assays to test for specificity of this DHX9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX9

Target: DHX9 (ATP-Dependent RNA Helicase A (DHX9))

Alternative Name: DHX9 (DHX9 Products)

Synonyms: DDX9 antibody, LKP antibody, NDH2 antibody, NDHII antibody, RHA antibody, AI326842 antibody, Ddx9 antibody, HEL-5 antibody, mHEL-5 antibody, DExH-box helicase 9 antibody, DEAH-box helicase 9 L homeolog antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 9 antibody, DHX9 antibody, dhx9.L antibody, Dhx9 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.

Molecular Weight: 141 kDa (MW of target protein)