DAZ3 antibody (Middle Region)
-
- Target See all DAZ3 Antibodies
- DAZ3 (Deleted In Azoospermia 3 (DAZ3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DAZ3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DAZ3 antibody was raised against the middle region of DAZ3
- Purification
- Affinity purified
- Immunogen
- DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF
- Top Product
- Discover our top product DAZ3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DAZ3 Blocking Peptide, catalog no. 33R-7082, is also available for use as a blocking control in assays to test for specificity of this DAZ3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAZ3 (Deleted In Azoospermia 3 (DAZ3))
- Alternative Name
- DAZ3 (DAZ3 Products)
- Synonyms
- pDP1679 antibody, DAZ3 antibody, DAZ2 antibody, deleted in azoospermia 3 antibody, deleted in azoospermia protein 3 antibody, DAZ3 antibody, LOC738636 antibody
- Background
- This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia.
- Molecular Weight
- 49 kDa (MW of target protein)
-