PABPC4 antibody (Middle Region)
-
- Target See all PABPC4 Antibodies
- PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PABPC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PABPC4 antibody was raised against the middle region of PABPC4
- Purification
- Affinity purified
- Immunogen
- PABPC4 antibody was raised using the middle region of PABPC4 corresponding to a region with amino acids RPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFG
- Top Product
- Discover our top product PABPC4 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PABPC4 Blocking Peptide, catalog no. 33R-8097, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))
- Alternative Name
- PABPC4 (PABPC4 Products)
- Synonyms
- cb12 antibody, sb:cb12 antibody, PABP antibody, ePAB antibody, ePABP antibody, APP-1 antibody, APP1 antibody, PABP4 antibody, iPABP antibody, polyadenylate-binding protein 4 antibody, poly(A) binding protein, cytoplasmic 4 antibody, poly(A) binding protein, cytoplasmic 4 (inducible form) antibody, poly(A) binding protein cytoplasmic 4 L homeolog antibody, poly(A) binding protein cytoplasmic 4 antibody, Bm1_06880 antibody, Pabpc4 antibody, pabpc4 antibody, pabpc4.L antibody, PABPC4 antibody
- Background
- Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets.
- Molecular Weight
- 71 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-