SNRPA1 antibody (Middle Region)
-
- Target See all SNRPA1 (SNRPA) Antibodies
- SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNRPA1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SNRPA antibody was raised against the middle region of SNRPA
- Purification
- Affinity purified
- Immunogen
- SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
- Top Product
- Discover our top product SNRPA Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))
- Alternative Name
- SNRPA (SNRPA Products)
- Synonyms
- Mud1 antibody, U1-A antibody, U1A antibody, im:7142962 antibody, zgc:101832 antibody, C430021M15Rik antibody, Rnu1a-1 antibody, Rnu1a1 antibody, mud1 antibody, snf antibody, fc19d01 antibody, wu:fc19d01 antibody, zgc:77810 antibody, T30B22.12 antibody, U1SNRNP-SPECIFIC PROTEIN antibody, spliceosomal protein U1A antibody, small nuclear ribonucleoprotein polypeptide A antibody, small nuclear ribonucleoprotein polypeptide A' antibody, small nuclear ribonucleoprotein polypeptide A S homeolog antibody, spliceosomal protein U1A antibody, SNRPA antibody, snrpa1 antibody, Snrpa antibody, snrpa.S antibody, snrpa antibody, U1A antibody
- Background
- SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.
- Molecular Weight
- 31 kDa (MW of target protein)
-