NOVA1 antibody (Middle Region)
-
- Target See all NOVA1 Antibodies
- NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NOVA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NOVA1 antibody was raised against the middle region of NOVA1
- Purification
- Affinity purified
- Immunogen
- NOVA1 antibody was raised using the middle region of NOVA1 corresponding to a region with amino acids TNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL
- Top Product
- Discover our top product NOVA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOVA1 Blocking Peptide, catalog no. 33R-9210, is also available for use as a blocking control in assays to test for specificity of this NOVA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))
- Alternative Name
- NOVA1 (NOVA1 Products)
- Synonyms
- Nova-1 antibody, NOVA1 antibody, si:ch211-222c22.9 antibody, 9430099M15Rik antibody, G630039L02 antibody, NOVA alternative splicing regulator 1 antibody, neuro-oncological ventral antigen 1 L homeolog antibody, neuro-oncological ventral antigen 1 antibody, RNA-binding protein Nova-1 antibody, lipid A export ATP-binding/permease protein antibody, NOVA1 antibody, Nova1 antibody, nova1.L antibody, nova1 antibody, LOC790874 antibody, novA1 antibody
- Background
- NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.
- Molecular Weight
- 52 kDa (MW of target protein)
-