IRAK3 antibody (C-Term)

Catalog No. ABIN633596

The Rabbit Polyclonal anti-IRAK3 antibody is suitable to detect IRAK3 in samples from Human. It has been validated for WB.

Quick Overview for IRAK3 antibody (C-Term) (ABIN633596)

Target: IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IRAK3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IRAK3 Antibody

Binding Specificity: C-Term

Specificity: IRAK3 antibody was raised against the C terminal of IRAK3

Purification: Affinity purified

Immunogen: IRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IRAK3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IRAK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRAK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IRAK3

Target: IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))

Alternative Name: IRAK3

Background: IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades