IRAK3 antibody (C-Term)
-
- Target See all IRAK3 Antibodies
- IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IRAK3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IRAK3 antibody was raised against the C terminal of IRAK3
- Purification
- Affinity purified
- Immunogen
- IRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
- Top Product
- Discover our top product IRAK3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IRAK3 Blocking Peptide, catalog no. 33R-6900, is also available for use as a blocking control in assays to test for specificity of this IRAK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRAK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))
- Alternative Name
- IRAK3 (IRAK3 Products)
- Synonyms
- IRAK3 antibody, si:dkey-150i15.2 antibody, ASRT5 antibody, IRAKM antibody, IrakM antibody, 4833428C18Rik antibody, AI563835 antibody, IRAK-M antibody, interleukin 1 receptor associated kinase 3 antibody, interleukin-1 receptor-associated kinase 3 antibody, IRAK3 antibody, irak3 antibody, Irak3 antibody
- Background
- IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.
- Molecular Weight
- 66 kDa (MW of target protein)
- Pathways
- TLR Signaling, Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades
-