KCNAB2 antibody (Middle Region)
-
- Target See all KCNAB2 Antibodies
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Rat, Human, Mouse, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNAB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNAB2 antibody was raised against the middle region of KCNAB2
- Purification
- Affinity purified
- Immunogen
- KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
- Top Product
- Discover our top product KCNAB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
- Alternative Name
- KCNAB2 (KCNAB2 Products)
- Synonyms
- kcnab2 antibody, KCNAB2 antibody, DKFZp459E056 antibody, akr6a5 antibody, kcna2b antibody, kvb-a antibody, kvb2 antibody, kvbeta2 antibody, kvbeta2.1 antibody, kvbeta2.2 antibody, AKR6A5 antibody, HKvbeta2 antibody, HKvbeta2.1 antibody, HKvbeta2.2 antibody, KCNA2B antibody, KV-BETA-2 antibody, Kvbeta2.1 antibody, F5 antibody, I2rf5 antibody, Kcnb3 antibody, kv-beta-2 antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 1 antibody, potassium voltage-gated channel subfamily A regulatory beta subunit 2 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 2 a antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog antibody, voltage-gated potassium channel subunit beta-2 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 2 antibody, kcnab1 antibody, KCNAB2 antibody, kcnab2a antibody, kcnab2.L antibody, LOC397248 antibody, Kcnab2 antibody
- Background
- The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNAB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits.
- Molecular Weight
- 40 kDa (MW of target protein)
-