KCNMA1 antibody (Middle Region)
-
- Target See all KCNMA1 Antibodies
- KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNMA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNMA1 antibody was raised against the middle region of KCNMA1
- Purification
- Affinity purified
- Immunogen
- KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD
- Top Product
- Discover our top product KCNMA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNMA1 Blocking Peptide, catalog no. 33R-2744, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))
- Alternative Name
- KCNMA1 (KCNMA1 Products)
- Synonyms
- BKTM antibody, KCa1.1 antibody, MaxiK antibody, SAKCA antibody, SLO antibody, SLO-ALPHA antibody, SLO1 antibody, bA205K10.1 antibody, mSLO1 antibody, DDBDRAFT_0190653 antibody, DDBDRAFT_0235401 antibody, DDB_0190653 antibody, DDB_0235401 antibody, KCNMA antibody, KCNMA1 antibody, 5730414M22Rik antibody, BKCa antibody, Slo antibody, Slo1 antibody, mSlo antibody, mSlo1 antibody, KCNMA1b antibody, KCNMA1c antibody, Kcnma antibody, bktm antibody, kcnma1-A antibody, sakca antibody, cSlo antibody, slo1 antibody, kcnma1 antibody, si:ch211-39f22.2 antibody, BcDNA:GH10751 antibody, CG10693 antibody, Dmel\CG10693 antibody, Dslo antibody, dSlo antibody, dSlo1 antibody, dslo antibody, fSlo antibody, potassium calcium-activated channel subfamily M alpha 1 antibody, calcium-activated BK potassium channel, alpha subunit antibody, potassium large conductance calcium-activated channel, subfamily M, alpha member 1 antibody, potassium calcium-activated channel subfamily M alpha 1 L homeolog antibody, potassium large conductance calcium-activated channel, subfamily M, alpha member 1a antibody, calcium-activated potassium channel subunit alpha-1 antibody, slowpoke antibody, KCNMA1 antibody, kcnma1 antibody, Kcnma1 antibody, kcnma1.L antibody, kcnma1a antibody, LOC100454095 antibody, slo antibody
- Background
- This protein is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.
- Molecular Weight
- 131 kDa (MW of target protein)
- Pathways
- Regulation of Hormone Metabolic Process, Sensory Perception of Sound
-