CACNA1G antibody (Middle Region)

Catalog No. ABIN633723

Product Details anti-CACNA1G Antibody

Target: CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNA1G antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNA1 G antibody was raised against the middle region of CACNA1

Purification: Affinity purified

Immunogen: CACNA1 G antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNA1G Blocking Peptide, catalog no. 33R-9823, is also available for use as a blocking control in assays to test for specificity of this CACNA1G antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNA1G

Target: CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))

Alternative Name: CACNA1G (CACNA1G Products)

Synonyms: CACNA1G antibody, cav3.1 antibody, ca(v)3.1 antibody, Ca(V)T.1 antibody, Cav3.1 antibody, NBR13 antibody, Cav3.1d antibody, [a]1G antibody, a1G antibody, alpha-1G antibody, mKIAA1123 antibody, Ca(v)3.1 antibody, calcium voltage-gated channel subunit alpha1 G antibody, calcium channel, voltage-dependent, T type, alpha 1G subunit antibody, calcium channel, voltage-dependent, T type, alpha 1G subunit L homeolog antibody, CACNA1G antibody, cacna1g antibody, cacna1g.L antibody, Cacna1g antibody

Background: Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance.

Molecular Weight: 241 kDa (MW of target protein)