CACNA1G antibody (Middle Region)
-
- Target See all CACNA1G Antibodies
- CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNA1G antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNA1 G antibody was raised against the middle region of CACNA1
- Purification
- Affinity purified
- Immunogen
- CACNA1 G antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
- Top Product
- Discover our top product CACNA1G Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNA1G Blocking Peptide, catalog no. 33R-9823, is also available for use as a blocking control in assays to test for specificity of this CACNA1G antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))
- Alternative Name
- CACNA1G (CACNA1G Products)
- Synonyms
- CACNA1G antibody, cav3.1 antibody, ca(v)3.1 antibody, Ca(V)T.1 antibody, Cav3.1 antibody, NBR13 antibody, Cav3.1d antibody, [a]1G antibody, a1G antibody, alpha-1G antibody, mKIAA1123 antibody, Ca(v)3.1 antibody, calcium voltage-gated channel subunit alpha1 G antibody, calcium channel, voltage-dependent, T type, alpha 1G subunit antibody, calcium channel, voltage-dependent, T type, alpha 1G subunit L homeolog antibody, CACNA1G antibody, cacna1g antibody, cacna1g.L antibody, Cacna1g antibody
- Background
- Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance.
- Molecular Weight
- 241 kDa (MW of target protein)
-