KCNMA1 antibody (Middle Region)

Catalog No. ABIN633725

Product Details anti-KCNMA1 Antibody

Target: KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNMA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNMA1 antibody was raised against the middle region of KCNMA1

Purification: Affinity purified

Immunogen: KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNMA1 Blocking Peptide, catalog no. 33R-1683, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNMA1

Target: KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))

Alternative Name: KCNMA1 (KCNMA1 Products)

Synonyms: BKTM antibody, KCa1.1 antibody, MaxiK antibody, SAKCA antibody, SLO antibody, SLO-ALPHA antibody, SLO1 antibody, bA205K10.1 antibody, mSLO1 antibody, DDBDRAFT_0190653 antibody, DDBDRAFT_0235401 antibody, DDB_0190653 antibody, DDB_0235401 antibody, KCNMA antibody, KCNMA1 antibody, 5730414M22Rik antibody, BKCa antibody, Slo antibody, Slo1 antibody, mSlo antibody, mSlo1 antibody, KCNMA1b antibody, KCNMA1c antibody, Kcnma antibody, bktm antibody, kcnma1-A antibody, sakca antibody, cSlo antibody, slo1 antibody, kcnma1 antibody, si:ch211-39f22.2 antibody, BcDNA:GH10751 antibody, CG10693 antibody, Dmel\CG10693 antibody, Dslo antibody, dSlo antibody, dSlo1 antibody, dslo antibody, fSlo antibody, potassium calcium-activated channel subfamily M alpha 1 antibody, calcium-activated BK potassium channel, alpha subunit antibody, potassium large conductance calcium-activated channel, subfamily M, alpha member 1 antibody, potassium calcium-activated channel subfamily M alpha 1 L homeolog antibody, potassium large conductance calcium-activated channel, subfamily M, alpha member 1a antibody, calcium-activated potassium channel subunit alpha-1 antibody, slowpoke antibody, KCNMA1 antibody, kcnma1 antibody, Kcnma1 antibody, kcnma1.L antibody, kcnma1a antibody, LOC100454095 antibody, slo antibody

Background: MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability.

Molecular Weight: 131 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Sensory Perception of Sound