P2RX5 antibody (N-Term)

Catalog No. ABIN633736

Product Details anti-P2RX5 Antibody

Target: P2RX5 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 5 (P2RX5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RX5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P2 RX5 antibody was raised against the N terminal of P2 X5

Purification: Affinity purified

Immunogen: P2 RX5 antibody was raised using the N terminal of P2 X5 corresponding to a region with amino acids LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RX5 Blocking Peptide, catalog no. 33R-5178, is also available for use as a blocking control in assays to test for specificity of this P2RX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RX5

Target: P2RX5 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 5 (P2RX5))

Alternative Name: P2RX5 (P2RX5 Products)

Synonyms: P2RX5 antibody, LRH-1 antibody, P2X5 antibody, P2X5R antibody, P2x5 antibody, purinergic receptor P2X 5 antibody, purinergic receptor P2X, ligand-gated ion channel, 5 antibody, P2RX5 antibody, P2rx5 antibody

Background: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.

Molecular Weight: 47 kDa (MW of target protein)