P2RX5 antibody (N-Term)
-
- Target See all P2RX5 Antibodies
- P2RX5 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 5 (P2RX5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RX5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- P2 RX5 antibody was raised against the N terminal of P2 X5
- Purification
- Affinity purified
- Immunogen
- P2 RX5 antibody was raised using the N terminal of P2 X5 corresponding to a region with amino acids LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR
- Top Product
- Discover our top product P2RX5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RX5 Blocking Peptide, catalog no. 33R-5178, is also available for use as a blocking control in assays to test for specificity of this P2RX5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX5 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 5 (P2RX5))
- Alternative Name
- P2RX5 (P2RX5 Products)
- Synonyms
- P2RX5 antibody, LRH-1 antibody, P2X5 antibody, P2X5R antibody, P2x5 antibody, purinergic receptor P2X 5 antibody, purinergic receptor P2X, ligand-gated ion channel, 5 antibody, P2RX5 antibody, P2rx5 antibody
- Background
- The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.
- Molecular Weight
- 47 kDa (MW of target protein)
-