P2RX4 antibody (N-Term)
-
- Target See all P2RX4 Antibodies
- P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RX4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- P2 RX4 antibody was raised against the N terminal of P2 X4
- Purification
- Affinity purified
- Immunogen
- P2 RX4 antibody was raised using the N terminal of P2 X4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW
- Top Product
- Discover our top product P2RX4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RX4 Blocking Peptide, catalog no. 33R-9751, is also available for use as a blocking control in assays to test for specificity of this P2RX4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))
- Alternative Name
- P2RX4 (P2RX4 Products)
- Synonyms
- P2X4 antibody, P2X4R antibody, AI504491 antibody, AW555605 antibody, D5Ertd444e antibody, p2rx4 antibody, p2x4 antibody, wu:fi03f02 antibody, p2x4r antibody, p2rx4.2 antibody, p2xr4.2 antibody, purinergic receptor P2X 4 antibody, purinergic receptor P2X, ligand-gated ion channel 4 antibody, purinergic receptor P2X, ligand-gated ion channel, 4a antibody, purinergic receptor P2X, ligand gated ion channel, 4 L homeolog antibody, purinergic receptor P2X, ligand-gated ion channel, 4b antibody, P2RX4 antibody, P2rx4 antibody, p2rx4a antibody, p2rx4.L antibody, p2rx4b antibody
- Background
- The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-