CHRNA4 antibody (N-Term)

Catalog No. ABIN633758

Product Details anti-CHRNA4 Antibody

Target: CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHRNA4 antibody was raised against the N terminal of CHRNA4

Purification: Affinity purified

Immunogen: CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA4 Blocking Peptide, catalog no. 33R-1126, is also available for use as a blocking control in assays to test for specificity of this CHRNA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA4

Target: CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))

Alternative Name: CHRNA4 (CHRNA4 Products)

Synonyms: NACHRA4 antibody, BFNC antibody, EBN antibody, EBN1 antibody, NACHR antibody, NACRA4 antibody, NARAC antibody, Acra-4 antibody, Acra4 antibody, ENFL1 antibody, neuronal acetylcholine receptor subunit alpha-4 antibody, neuronal acetylcholine receptor subunit alpha-4-like antibody, cholinergic receptor nicotinic alpha 4 subunit antibody, cholinergic receptor, nicotinic, alpha 4b antibody, cholinergic receptor, nicotinic, alpha polypeptide 4 antibody, CpipJ_CPIJ002434 antibody, LOC100368057 antibody, CHRNA4 antibody, chrna4b antibody, Chrna4 antibody

Background: CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Synaptic Membrane