GABRA5 antibody
-
- Target See all GABRA5 Antibodies
- GABRA5 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GABRA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE
- Top Product
- Discover our top product GABRA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GABRA5 Blocking Peptide, catalog no. 33R-1296, is also available for use as a blocking control in assays to test for specificity of this GABRA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABRA5 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5))
- Alternative Name
- GABRA5 (GABRA5 Products)
- Synonyms
- GABRA5 antibody, si:dkey-93p24.1 antibody, A230018I05Rik antibody, gamma-aminobutyric acid type A receptor alpha5 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody, gamma-aminobutyric acid type A receptor alpha 5 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 antibody, gamma-aminobutyric acid receptor subunit alpha-5 antibody, GABRA5 antibody, gabra5 antibody, Gabra5 antibody, LOC100653497 antibody
- Background
- GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Synaptic Membrane
-