KCNK15 antibody (Middle Region)
-
- Target See all KCNK15 Antibodies
- KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNK15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNK15 antibody was raised against the middle region of KCNK15
- Purification
- Affinity purified
- Immunogen
- KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI
- Top Product
- Discover our top product KCNK15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNK15 Blocking Peptide, catalog no. 33R-1496, is also available for use as a blocking control in assays to test for specificity of this KCNK15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))
- Alternative Name
- KCNK15 (KCNK15 Products)
- Synonyms
- zgc:171568 antibody, K2p15.1 antibody, KCNK11 antibody, KCNK14 antibody, KT3.3 antibody, TASK-5 antibody, TASK5 antibody, dJ781B1.1 antibody, potassium two pore domain channel subfamily K member 15 antibody, potassium channel, subfamily K, member 15 antibody, Potassium channel subfamily K member 15 antibody, KCNK15 antibody, kcnk15 antibody, kcnkf antibody, Kcnk15 antibody
- Background
- KCNK15 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK15 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Molecular Weight
- 36 kDa (MW of target protein)
-