PRR5 antibody
-
- Target See all PRR5 Antibodies
- PRR5 (Proline Rich 5 (Renal) (PRR5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRR5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS
- Top Product
- Discover our top product PRR5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRR5 Blocking Peptide, catalog no. 33R-3387, is also available for use as a blocking control in assays to test for specificity of this PRR5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRR5 (Proline Rich 5 (Renal) (PRR5))
- Alternative Name
- PRR5 (PRR5 Products)
- Synonyms
- AU043908 antibody, Arhgap8 antibody, C030017C09Rik antibody, C78947 antibody, Protor-1 antibody, Protor1 antibody, FLJ20185k antibody, PP610 antibody, PROTOR-1 antibody, PROTOR1 antibody, pp610 antibody, protor1 antibody, protor2 antibody, proline rich 5 (renal) antibody, proline rich 5 antibody, proline rich 5 L homeolog antibody, Prr5 antibody, PRR5 antibody, prr5.L antibody
- Background
- This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling
-