Cardiotrophin 1 antibody (N-Term)
-
- Target See all Cardiotrophin 1 (CTF1) Antibodies
- Cardiotrophin 1 (CTF1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cardiotrophin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cardiotrophin 1 antibody was raised against the N terminal of CTF1
- Purification
- Affinity purified
- Immunogen
- Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
- Top Product
- Discover our top product CTF1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cardiotrophin 1 Blocking Peptide, catalog no. 33R-6489, is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cardiotrophin 1 (CTF1)
- Alternative Name
- Cardiotrophin 1 (CTF1 Products)
- Synonyms
- CTF1 antibody, ct1 antibody, ct-1 antibody, ctf2 antibody, CT-1 antibody, CT1 antibody, cardiotrophin 1 antibody, cardiotrophin-1 antibody, CTF1 antibody, ctf1 antibody, Ctf1 antibody, LOC100736818 antibody
- Background
- CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling
-