Angiopoietin 4 antibody (N-Term)

Catalog No. ABIN633842

The Rabbit Polyclonal anti-Angiopoietin 4 antibody is suitable to detect Angiopoietin 4 in samples from Human. It has been validated for WB.

Quick Overview for Angiopoietin 4 antibody (N-Term) (ABIN633842)

Target: Angiopoietin 4 (ANGPT4)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Angiopoietin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Angiopoietin 4 Antibody

Binding Specificity: N-Term

Specificity: ANGPT4 antibody was raised against the N terminal of ANGPT4

Purification: Affinity purified

Immunogen: ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANGPT4 Blocking Peptide, (ABIN5612056), is also available for use as a blocking control in assays to test for specificity of this ANGPT4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Angiopoietin 4

Target: Angiopoietin 4 (ANGPT4)

Alternative Name: ANGPT4

Background: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: RTK Signaling