MST1 antibody
-
- Target See all MST1 Antibodies
- MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MST1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
- Top Product
- Discover our top product MST1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MST1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))
- Alternative Name
- MST1 (MST1 Products)
- Synonyms
- D3F15S2 antibody, DNF15S2 antibody, HGFL antibody, MSP antibody, NF15S2 antibody, E2F2 antibody, D3F15S2h antibody, D9H3F15S2 antibody, DNF15S2h antibody, Hgfl antibody, HGF1/MSP antibody, E1A antibody, XHL antibody, d3f15s2 antibody, dnf15s2 antibody, hgfl antibody, msp antibody, mst1 antibody, nf15s2 antibody, macrophage stimulating 1 antibody, macrophage stimulating 1 (hepatocyte growth factor-like) antibody, serine/threonine kinase 4 antibody, macrophage stimulating 1 L homeolog antibody, MST1 antibody, Mst1 antibody, STK4 antibody, mst1.L antibody
- Background
- MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
- Molecular Weight
- 80 kDa (MW of target protein)
-