MST1 antibody

Catalog No. ABIN633854

Product Details anti-MST1 Antibody

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MST1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MST1

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Alternative Name: MST1 (MST1 Products)

Synonyms: D3F15S2 antibody, DNF15S2 antibody, HGFL antibody, MSP antibody, NF15S2 antibody, E2F2 antibody, D3F15S2h antibody, D9H3F15S2 antibody, DNF15S2h antibody, Hgfl antibody, HGF1/MSP antibody, E1A antibody, XHL antibody, d3f15s2 antibody, dnf15s2 antibody, hgfl antibody, msp antibody, mst1 antibody, nf15s2 antibody, macrophage stimulating 1 antibody, macrophage stimulating 1 (hepatocyte growth factor-like) antibody, serine/threonine kinase 4 antibody, macrophage stimulating 1 L homeolog antibody, MST1 antibody, Mst1 antibody, STK4 antibody, mst1.L antibody

Background: MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.

Molecular Weight: 80 kDa (MW of target protein)