CYP1B1 antibody (Middle Region)
-
- Target See all CYP1B1 Antibodies
- CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP1B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP1 B1 antibody was raised against the middle region of CYP1 1
- Purification
- Affinity purified
- Immunogen
- CYP1 B1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
- Top Product
- Discover our top product CYP1B1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP1B1 Blocking Peptide, catalog no. 33R-1584, is also available for use as a blocking control in assays to test for specificity of this CYP1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))
- Alternative Name
- CYP1B1 (CYP1B1 Products)
- Synonyms
- CP1B antibody, CYPIB1 antibody, GLC3A antibody, P4501B1 antibody, P4501b1 antibody, CYP1B1 antibody, CYP1B antibody, zgc:136223 antibody, cytochrome P450 family 1 subfamily B member 1 antibody, cytochrome P450, family 1, subfamily b, polypeptide 1 antibody, cytochrome P450, family 1, subfamily B, polypeptide 1 antibody, cytochrome P450 1B1 antibody, CYP1B1 antibody, Cyp1b1 antibody, cyp1b1 antibody, LOC100719054 antibody
- Background
- CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma, therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-