FCN1 antibody

Catalog No. ABIN633978

Product Details anti-FCN1 Antibody

Target: FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCN1 Blocking Peptide, catalog no. 33R-3578, is also available for use as a blocking control in assays to test for specificity of this FCN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FCN1

Target: FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))

Alternative Name: FCN1 (FCN1 Products)

Synonyms: FCNM antibody, FCNB antibody, FCN2 antibody, FCN1 antibody, ficolin 1 antibody, ficolin (collagen/fibrinogen domain containing) 1 antibody, ficolin-1 antibody, FCN1 antibody, Fcn1 antibody, LOC100069029 antibody

Background: The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognise different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Complement System