DAO antibody (C-Term)

Catalog No. ABIN634013

Product Details anti-DAO Antibody

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAO antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ABP1 antibody was raised against the C terminal of ABP1

Purification: Affinity purified

Immunogen: ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABP1 Blocking Peptide, catalog no. 33R-7547, is also available for use as a blocking control in assays to test for specificity of this ABP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAO

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Alternative Name: ABP1 (ABP1 Products)

Synonyms: ABP antibody, ABP1 antibody, DAO antibody, DAO1 antibody, KAO antibody, 1600012D06Rik antibody, Abp1 antibody, abp1 antibody, si:ch211-286c5.2 antibody, zgc:154101 antibody, Abp antibody, dao antibody, amine oxidase, copper containing 1 antibody, amine oxidase, copper-containing 1 antibody, AOC1 antibody, Aoc1 antibody, aoc1 antibody

Background: ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.

Molecular Weight: 83 kDa (MW of target protein)