RBP4 antibody (N-Term)

Catalog No. ABIN634030

Product Details anti-RBP4 Antibody

Target: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBP4 antibody was raised against the N terminal of RBP4

Purification: Affinity purified

Immunogen: RBP4 antibody was raised using the N terminal of RBP4 corresponding to a region with amino acids MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBP4 Blocking Peptide, catalog no. 33R-6173, is also available for use as a blocking control in assays to test for specificity of this RBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBP4

Target: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Alternative Name: RBP4 (RBP4 Products)

Synonyms: RDCCAS antibody, RBP antibody, RNBP antibody, rbp4 antibody, MGC54038 antibody, srbp antibody, PRBP antibody, RBPA antibody, Rbp-4 antibody, fb23c12 antibody, rbp antibody, wu:fb23c12 antibody, wu:fb58d04 antibody, wu:fb72b04 antibody, zgc:86911 antibody, retinol binding protein 4 antibody, renin binding protein antibody, retinol binding protein 4 S homeolog antibody, retinol binding protein 4 A, plasma antibody, retinol binding protein 4, plasma antibody, retinol binding protein 4 L homeolog antibody, RBP4 antibody, RENBP antibody, rbp4.S antibody, rbp4 antibody, Rbp4 antibody, RBP4A antibody, rbp4.L antibody

Background: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis, Production of Molecular Mediator of Immune Response