ASAH1 antibody
-
- Target See all ASAH1 Antibodies
- ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASAH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP
- Top Product
- Discover our top product ASAH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASAH1 Blocking Peptide, catalog no. 33R-7724, is also available for use as a blocking control in assays to test for specificity of this ASAH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASAH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))
- Alternative Name
- ASAH1 (ASAH1 Products)
- Synonyms
- AC antibody, ACDase antibody, ASAH antibody, PHP antibody, PHP32 antibody, SMAPME antibody, 2310081N20Rik antibody, Asah antibody, MGC82286 antibody, asah1 antibody, zgc:101637 antibody, ASAH1 antibody, zgc:66026 antibody, N-acylsphingosine amidohydrolase 1 antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1 antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1 L homeolog antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1a antibody, Acid ceramidase antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1b antibody, ASAH1 antibody, Asah1 antibody, asah1.L antibody, asah1a antibody, asah-1 antibody, asah1b antibody
- Background
- This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.
- Molecular Weight
- 14 kDa (MW of target protein)
-