CDKN3 antibody
-
- Target See all CDKN3 Antibodies
- CDKN3 (Cyclin-Dependent Kinase Inhibitor 3 (CDKN3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDKN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG
- Top Product
- Discover our top product CDKN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDKN3 Blocking Peptide, catalog no. 33R-1720, is also available for use as a blocking control in assays to test for specificity of this CDKN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDKN3 (Cyclin-Dependent Kinase Inhibitor 3 (CDKN3))
- Alternative Name
- CDKN3 (CDKN3 Products)
- Synonyms
- CDI1 antibody, CIP2 antibody, KAP antibody, KAP1 antibody, CDKN3 antibody, 2410006H10Rik antibody, K24G6.15 antibody, K24G6_15 antibody, KIP-RELATED PROTEIN 3 antibody, KRP3 antibody, inhibitor/interactor with cyclin-dependent kinase antibody, cyclin dependent kinase inhibitor 3 antibody, cyclin-dependent kinase inhibitor 3 antibody, inhibitor/interactor with cyclin-dependent kinase antibody, CDKN3 antibody, cdkn3 antibody, Cdkn3 antibody, ICK6 antibody
- Background
- The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.
- Molecular Weight
- 23 kDa (MW of target protein)
-