HERC5 antibody (Middle Region)
-
- Target See all HERC5 Antibodies
- HERC5 (Hect Domain and RLD 5 (HERC5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HERC5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HERC5 antibody was raised against the middle region of HERC5
- Purification
- Affinity purified
- Immunogen
- HERC5 antibody was raised using the middle region of HERC5 corresponding to a region with amino acids FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
- Top Product
- Discover our top product HERC5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HERC5 Blocking Peptide, catalog no. 33R-2921, is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HERC5 (Hect Domain and RLD 5 (HERC5))
- Alternative Name
- HERC5 (HERC5 Products)
- Synonyms
- HERC5 antibody, CEB1 antibody, CEBP1 antibody, HECT and RLD domain containing E3 ubiquitin protein ligase 5 antibody, hect domain and RLD 5 antibody, HERC5 antibody
- Background
- This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.
- Molecular Weight
- 117 kDa (MW of target protein)
-