XRCC2 antibody (Middle Region)
-
- Target See all XRCC2 Antibodies
- XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XRCC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- XRCC2 antibody was raised against the middle region of XRCC2
- Purification
- Affinity purified
- Immunogen
- XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
- Top Product
- Discover our top product XRCC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XRCC2 Blocking Peptide, catalog no. 33R-1740, is also available for use as a blocking control in assays to test for specificity of this XRCC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))
- Alternative Name
- XRCC2 (XRCC2 Products)
- Synonyms
- XRCC2 antibody, 4921524O04Rik antibody, 8030409M04Rik antibody, RAD51 antibody, RecA antibody, RGD1564823 antibody, X-ray repair cross complementing 2 antibody, X-ray repair complementing defective repair in Chinese hamster cells 2 antibody, XRCC2 antibody, Xrcc2 antibody
- Background
- XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-