MSH5 antibody
-
- Target See all MSH5 Antibodies
- MSH5 (MutS Homolog 5 (MSH5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MSH5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI
- Top Product
- Discover our top product MSH5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MSH5 Blocking Peptide, catalog no. 33R-4613, is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSH5 (MutS Homolog 5 (MSH5))
- Alternative Name
- MSH5 (MSH5 Products)
- Synonyms
- MSH5 antibody, G7 antibody, MUTSH5 antibody, NG23 antibody, Mut5 antibody, mutS homolog 5 antibody, mutS protein homolog 5 antibody, MSH (MutS Homolog) family antibody, MSH5 antibody, msh5 antibody, LOC100635155 antibody, Msh5 antibody, msh-5 antibody
- Background
- MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over.
- Molecular Weight
- 95 kDa (MW of target protein)
- Pathways
- M Phase
-