PAFAH1B1 antibody (N-Term)
-
- Target See all PAFAH1B1 Antibodies
- PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAFAH1B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PAFAH1 B1 antibody was raised against the N terminal of PAFAH1 1
- Purification
- Affinity purified
- Immunogen
- PAFAH1 B1 antibody was raised using the N terminal of PAFAH1 1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
- Top Product
- Discover our top product PAFAH1B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAFAH1B1 Blocking Peptide, catalog no. 33R-6595, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAFAH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))
- Alternative Name
- PAFAH1B1 (PAFAH1B1 Products)
- Synonyms
- LIS1 antibody, LIS2 antibody, MDCR antibody, MDS antibody, PAFAH antibody, LIS-1 antibody, Lis1 antibody, MMS10-U antibody, Mdsh antibody, Ms10u antibody, Pafaha antibody, lis2 antibody, mdcr antibody, mds antibody, pafah antibody, pafah1b1-b antibody, PAFAHA antibody, Lis1a antibody, platelet activating factor acetylhydrolase 1b regulatory subunit 1 antibody, platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 antibody, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 antibody, platelet activating factor acetylhydrolase 1b regulatory subunit 1 L homeolog antibody, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a antibody, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b antibody, PAFAH1B1 antibody, Pafah1b1 antibody, pafah1b1.L antibody, pafah1b1a antibody, pafah1b1b antibody
- Background
- This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- M Phase, Regulation of Cell Size
-