K-RAS antibody (N-Term)
-
- Target See all K-RAS (KRAS) Antibodies
- K-RAS (KRAS) (GTPase Kras (KRAS))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This K-RAS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KRAS antibody was raised against the N terminal of KRAS
- Purification
- Affinity purified
- Immunogen
- KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
- Top Product
- Discover our top product KRAS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KRAS Blocking Peptide, catalog no. 33R-9058, is also available for use as a blocking control in assays to test for specificity of this KRAS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRAS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- K-RAS (KRAS) (GTPase Kras (KRAS))
- Alternative Name
- KRAS (KRAS Products)
- Synonyms
- wu:fa04e08 antibody, wu:fc14b12 antibody, wu:fc23g10 antibody, wu:fj89d12 antibody, zgc:85725 antibody, Kras2 antibody, c-Ki-ras antibody, p21 antibody, C-K-RAS antibody, CFC2 antibody, K-RAS2A antibody, K-RAS2B antibody, K-RAS4A antibody, K-RAS4B antibody, KI-RAS antibody, KRAS1 antibody, KRAS2 antibody, NS antibody, NS3 antibody, RASK2 antibody, AI929937 antibody, K-ras antibody, Ki-ras antibody, Kras-2 antibody, p21B antibody, ras antibody, k-ras antibody, kras antibody, kras-a antibody, kras-b antibody, rask2 antibody, K-RAS antibody, p21ras antibody, KRAS proto-oncogene, GTPase antibody, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog antibody, Kirsten rat sarcoma viral oncogene homolog antibody, semicolonial-7 antibody, Ras family protein antibody, GTPase KRas antibody, Kirsten rat sarcoma viral oncogene homolog S homeolog antibody, KRAS antibody, kras antibody, Kras antibody, smco-7 antibody, PGTG_03066 antibody, Tsp_02666 antibody, Tsp_01642 antibody, rask antibody, kras.S antibody
- Target Type
- Viral Protein
- Background
- KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.
- Molecular Weight
- 22 kDa (MW of target protein)
-